PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013289
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 290aa    MW: 31137 Da    PI: 11.252
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013289genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.8e-14104148347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
      Lus10013289 104 PWTEEEHRLFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 148
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.614518IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.4897153IPR017930Myb domain
SuperFamilySSF466892.69E-1799153IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-17100151IPR006447Myb domain, plants
SMARTSM007172.2E-10101151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-11103148IPR009057Homeodomain-like
PfamPF002492.8E-11104148IPR001005SANT/Myb domain
CDDcd001671.67E-9104149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSRICSQCGN NGHNSRTCGG EMSSITSGDA TAAENGIMLF GVRLTAGMNN TFRKSASMNN  60
LSMYADHRNQ NSVADGVVVV ASGYESDDVV HASGRGRERK RGVPWTEEEH RLFLVGLQKV  120
GKGDWRGISR NFVKTRTPTQ VASHAQKYFL RRNNQNRRRR RSSLFDITTD NTPPPNQEAA  180
AAALFKVNSV HPSKFPVPTS PAATITGERL MLGQPTARTK VGRPIPLPPS SKMASLNLNQ  240
KQEPFLPLSL RLSPTPSSGE KSSSSSAGTR SSSSAFQGMS SGDSIISVA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438523.11e-98hypothetical protein CICLE_v10032167mg
TrEMBLV4SV571e-98V4SV57_9R
STRINGVIT_01s0026g01050.t018e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-69MYB_related family protein